Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR3 Peptide - middle region

SSR3 Peptide - middle region

Product Specifications

Product Name Alternative

TRAPG

UniProt

Q9UNL2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001295126.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylmalonic Acid Mono-5-indanyl Ester
TRC-P338340-250MG 250 mg

Phenylmalonic Acid Mono-5-indanyl Ester

Sign In for Pricing
View Details
C9 Mouse Gene Knockout Kit (CRISPR)
KN502397 1 Kit

C9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human GSDMC activation kit by CRISPRa
GA111150 1 Kit

Human GSDMC activation kit by CRISPRa

Sign In for Pricing
View Details
ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI1H8]
CF810217 100 µg

ZFP37 Mouse Monoclonal Antibody [Clone ID: OTI1H8]

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate
LY403449 100 µg

CNTF Receptor alpha (CNTFR) (NM_147164) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WFDC13 activation kit by CRISPRa
GA116108 1 Kit

Human WFDC13 activation kit by CRISPRa

Sign In for Pricing
View Details