Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR3 Peptide - middle region

SSR3 Peptide - middle region

Product Specifications

Product Name Alternative

TRAPG

UniProt

Q9UNL2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001295126.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVVVIVASFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Srp9 (NM_012058) Mouse Tagged ORF Clone
MG200190 10 µg

Srp9 (NM_012058) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Man a(1,6) [Man a(1,3)] Man a-O-BSA Colloidal Gold Conjugate, 1mL 20nm
CCG-1014-20 1 mL

Man a(1,6) [Man a(1,3)] Man a-O-BSA Colloidal Gold Conjugate, 1mL 20nm

Sign In for Pricing
View Details
SARS-CoV-2 S1 protein (L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y), Fc Tag
S1D-C5253-1mg 1 mg

SARS-CoV-2 S1 protein (L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y), Fc Tag

Sign In for Pricing
View Details
galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)
KN210750RB 1 Kit

galectin 9 (LGALS9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NDOR1 (NM_001144026) Human Over-expression Lysate
LY428473 100 µg

NDOR1 (NM_001144026) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Brain
CR559775 5 µg

Tissue Total RNA, Brain

Sign In for Pricing
View Details