Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR3 Peptide - N-terminal region

SSR3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRAPG

UniProt

Q9UNL2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001295126.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772G-01 20 Tests

PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772G-02 100 Tests

PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]
E-AB-F09772G-03 2x 100 Tests

PE/Cyanine5 Rat IgM, κ Isotype Control[RTK2118]

Sign In for Pricing
View Details
CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF568 conjugate, 0.1mg/mL
BNC681318-100 1x 100 µL

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FITC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UC-01 25 µg

FITC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UC-02 100 µg

FITC Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details