Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSR3 Peptide - N-terminal region

SSR3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRAPG

UniProt

Q9UNL2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001295126.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), 0.2mg/mL
BNUB2055-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), 0.2mg/mL

Sign In for Pricing
View Details
CEBP Alpha (CEBPA) Mouse Monoclonal Antibody [Clone ID: 5B7]
AM06759SU-N 100 µL

CEBP Alpha (CEBPA) Mouse Monoclonal Antibody [Clone ID: 5B7]

Sign In for Pricing
View Details
ECM1 Polyclonal Antibody
E-AB-53374-01 20 µL

ECM1 Polyclonal Antibody

Sign In for Pricing
View Details
ECM1 Polyclonal Antibody
E-AB-53374-02 60 µL

ECM1 Polyclonal Antibody

Sign In for Pricing
View Details
ECM1 Polyclonal Antibody
E-AB-53374-03 120 µL

ECM1 Polyclonal Antibody

Sign In for Pricing
View Details
ECM1 Polyclonal Antibody
E-AB-53374-04 200 µL

ECM1 Polyclonal Antibody

Sign In for Pricing
View Details