Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT5 Peptide - middle region

TRMT5 Peptide - middle region

Product Specifications

Product Name Alternative

TRM5, KIAA1393

UniProt

Q32P41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065861.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Acid Phosphatase, ACP1 ELISA KIT
E0233Ch-01 48 Well

Chicken Acid Phosphatase, ACP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Acid Phosphatase, ACP1 ELISA KIT
E0233Ch-02 96 Well

Chicken Acid Phosphatase, ACP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Acid Phosphatase, ACP1 ELISA KIT
E0233Ch-03 5x 96 Tests

Chicken Acid Phosphatase, ACP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Acid Phosphatase, ACP1 ELISA KIT
E0233Ch-04 10x 96 Tests

Chicken Acid Phosphatase, ACP1 ELISA KIT

Sign In for Pricing
View Details
Synphilin-1 (Sph1, Alpha-synuclein-interacting Protein, SNCAIP) (Biotin)
134143-Biotin 100 µL

Synphilin-1 (Sph1, Alpha-synuclein-interacting Protein, SNCAIP) (Biotin)

Sign In for Pricing
View Details
Recombinant Human WBP1 (His)
BP4342-50ug 50 µg

Recombinant Human WBP1 (His)

Sign In for Pricing
View Details