Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRMT5 Peptide - middle region

TRMT5 Peptide - middle region

Product Specifications

Product Name Alternative

TRM5, KIAA1393

UniProt

Q32P41

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065861.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dclk1-set siRNA/shRNA/RNAi Lentivector (Rat)
17730096 4x 500 ng

Dclk1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Thiamine Impurity 36
RM-T090936-01 10 mg

Thiamine Impurity 36

Sign In for Pricing
View Details
Thiamine Impurity 36
RM-T090936-02 25 mg

Thiamine Impurity 36

Sign In for Pricing
View Details
Thiamine Impurity 36
RM-T090936-03 50 mg

Thiamine Impurity 36

Sign In for Pricing
View Details
Thiamine Impurity 36
RM-T090936-04 100 mg

Thiamine Impurity 36

Sign In for Pricing
View Details
Advillin (AVIL) (NM_006576) Human Tagged Lenti ORF Clone
RC212587L3 10 µg

Advillin (AVIL) (NM_006576) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details