Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5MF Peptide - middle region

ATP5MF Peptide - middle region

Product Specifications

Product Name Alternative

ATP5J2, ATP5JL

UniProt

P56134

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003713.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Galectin 9 (LGALS9) ELISA Kit-Sandwich
EK10F487-01 48 Test

Canine Galectin 9 (LGALS9) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Canine Galectin 9 (LGALS9) ELISA Kit-Sandwich
EK10F487-02 96 Tests

Canine Galectin 9 (LGALS9) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Anti-Cytokeratin 14 Antibody
MBS8211093-01 0.03 mL

Anti-Cytokeratin 14 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 14 Antibody
MBS8211093-02 0.05 mL

Anti-Cytokeratin 14 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 14 Antibody
MBS8211093-03 0.1 mL

Anti-Cytokeratin 14 Antibody

Sign In for Pricing
View Details
Anti-Cytokeratin 14 Antibody
MBS8211093-04 0.2 mL

Anti-Cytokeratin 14 Antibody

Sign In for Pricing
View Details