Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5MF Peptide - middle region

ATP5MF Peptide - middle region

Product Specifications

Product Name Alternative

ATP5J2, ATP5JL

UniProt

P56134

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001003713.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LC3C, phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 light chain 3 alpha) (FITC) discontinued
037702-FITC 200 µL

LC3C, phosphorylated (S12) (MAP1LC3A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 light chain 3 alpha) (FITC) discontinued

Sign In for Pricing
View Details
Anserini STK ELISA Kit
EAS0299 96 Tests

Anserini STK ELISA Kit

Sign In for Pricing
View Details
KCNAB2 Antibody - middle region
ARP35462_P050-25UL 25 µL

KCNAB2 Antibody - middle region

Sign In for Pricing
View Details
Human Endoplasmic Reticulum Aminopeptidase 2 (ERAP2) ELISA Kit
RD-ERAP2-Hu-48Tests 48 Tests

Human Endoplasmic Reticulum Aminopeptidase 2 (ERAP2) ELISA Kit

Sign In for Pricing
View Details
Adiponectin Receptor Protein 2 (AdipoR2) (Biotin) discontinued
214471-Biotin 100 µL

Adiponectin Receptor Protein 2 (AdipoR2) (Biotin) discontinued

Sign In for Pricing
View Details
SUHW3 Recombinant Protein Antigen
NBP2-38768PEP 0.1 mL

SUHW3 Recombinant Protein Antigen

Sign In for Pricing
View Details