What is the catalog number for IRS1 Peptide - C-terminal region?

The catalog number for IRS1 Peptide - C-terminal region is orb1998434.

What sizes are available for IRS1 Peptide - C-terminal region?

IRS1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IRS1 Peptide - C-terminal region in stock?

IRS1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IRS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIRS-1

UniProt

Q9ULL5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005535.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-400413-ACT-2 20 µg

EDG-1 CRISPR Activation Plasmid (h2)

Sign In for Pricing

View Details

TRV-0048216-01 20 µL

Polyclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing

View Details

TRV-0048216-02 100 µL

Polyclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing

View Details

TRV-0048216-03 200 µL

Polyclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing

View Details

TRV-0048216-04 1 mL

Polyclonal Antibody to Lecithin Cholesterol Acyltransferase (LCAT)

Sign In for Pricing

View Details

abx231702 100 µg

Protein Churchill (CHURC1) Antibody

Sign In for Pricing

View Details