Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRS1 Peptide - C-terminal region

IRS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HIRS-1

UniProt

Q9ULL5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005535.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YIDLDLVKDFKQCPQECTPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R9B ELISA Kit (Rat) (OKCA02578)
OKCA02578 96 Well

PPP1R9B ELISA Kit (Rat) (OKCA02578)

Sign In for Pricing
View Details
KAT13A/SRC1/NCOA1 Rabbit Polyclonal Antibody (HRP)
orb2622740 100 µg

KAT13A/SRC1/NCOA1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PRR25 siRNA (Human)
orb1850480-01 15 nmol

PRR25 siRNA (Human)

Sign In for Pricing
View Details
PRR25 siRNA (Human)
orb1850480-02 30 nmol

PRR25 siRNA (Human)

Sign In for Pricing
View Details
Sdhaf4 Mouse Gene Knockout Kit (CRISPR)
KN500029 1 Kit

Sdhaf4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chicken Arf-GAP domain and FG repeats-containing protein 1 (AGFG1) ELISA Kit
MBS7215463-01 48 Well

Chicken Arf-GAP domain and FG repeats-containing protein 1 (AGFG1) ELISA Kit

Sign In for Pricing
View Details