Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY1 Peptide - middle region

YY1 Peptide - middle region

Product Specifications

Product Name Alternative

YY1 transcription factor

UniProt

P25490

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003394.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human CD16 Antibody[3G8]
E-AB-F1236F-01 20 Tests

PerCP Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
PerCP Anti-Human CD16 Antibody[3G8]
E-AB-F1236F-02 100 Tests

PerCP Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
PerCP Anti-Human CD16 Antibody[3G8]
E-AB-F1236F-03 2x 100 Tests

PerCP Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
FAK Recombinant Rabbit monoclonal Antibody
HA750039 100 µL

FAK Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Beta-Actin Antibody
KC-2175-01 50 μL

Beta-Actin Antibody

Sign In for Pricing
View Details
Beta-Actin Antibody
KC-2175-02 100 µL

Beta-Actin Antibody

Sign In for Pricing
View Details