Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YY1 Peptide - middle region

YY1 Peptide - middle region

Product Specifications

Product Name Alternative

YY1 transcription factor

UniProt

P25490

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003394.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBPA (YBX3) (NM_003651) Human Recombinant Protein
TP305856M 100 µg

DBPA (YBX3) (NM_003651) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse L-Selectin/CD62L Protein (His Tag)
PDMM100138-01 20 µg

Recombinant Mouse L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse L-Selectin/CD62L Protein (His Tag)
PDMM100138-02 100 µg

Recombinant Mouse L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse L-Selectin/CD62L Protein (His Tag)
PDMM100138-03 500 µg

Recombinant Mouse L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse L-Selectin/CD62L Protein (His Tag)
PDMM100138-04 1 mg

Recombinant Mouse L-Selectin/CD62L Protein (His Tag)

Sign In for Pricing
View Details
PEX16 (Center) Rabbit Polyclonal Antibody
AP53262PU-N 400 µL

PEX16 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details