Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FRS2 Peptide - middle region

FRS2 Peptide - middle region

Product Specifications

Product Name Alternative

SNT, SNT1, FRS1A, FRS2A, SNT-1, FRS2alpha

UniProt

Q8WU20

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036020.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ANNTEWDTGYDSDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSTST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX Human Gene Knockout Kit (CRISPR)
KN215176BN 1 Kit

ATRX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C4orf27 (HPF1) activation kit by CRISPRa
GA110414 1 Kit

Human C4orf27 (HPF1) activation kit by CRISPRa

Sign In for Pricing
View Details
TRIM29 (TRIM29/1041), CF647 conjugate, 0.1mg/mL
BNC471041-100 1x 100 µL

TRIM29 (TRIM29/1041), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MRP5 (ABCC5) Mouse Monoclonal Antibody [Clone ID: OTI5A8]
CF808322 100 µg

MRP5 (ABCC5) Mouse Monoclonal Antibody [Clone ID: OTI5A8]

Sign In for Pricing
View Details
HRG (NM_000412) Human Over-expression Lysate
LC424735 20 µg

HRG (NM_000412) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SNX8 activation kit by CRISPRa
GA109289 1 Kit

Human SNX8 activation kit by CRISPRa

Sign In for Pricing
View Details