Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Peptide - N-terminal region

POU2F1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OCT1, OTF1, oct-1B

UniProt

P14859

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

lacI Rabbit Polyclonal Antibody
AP09404PU-N 100 µg

lacI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GPR17 Mouse Monoclonal Antibody [Clone ID: OTI6A3]
CF811586 100 µg

GPR17 Mouse Monoclonal Antibody [Clone ID: OTI6A3]

Sign In for Pricing
View Details
Creatine kinase M type (CKM) (N-term) Goat Polyclonal Antibody
AP32737PU-N 100 µg

Creatine kinase M type (CKM) (N-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
2,2-Bis[4-[2-(diethylamino)ethoxy]phenyl]-1,2-diphenylethanone Dihydrochloride
TRC-B426250-25MG 25 mg

2,2-Bis[4-[2-(diethylamino)ethoxy]phenyl]-1,2-diphenylethanone Dihydrochloride

Sign In for Pricing
View Details
Snta1 Mouse Gene Knockout Kit (CRISPR)
KN316412BN 1 Kit

Snta1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC471204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details