Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Peptide - N-terminal region

POU2F1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

OCT1, OTF1, oct-1B

UniProt

P14859

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001185712.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CH-PIATA
TRC-C394580-10MG 10 mg

CH-PIATA

Sign In for Pricing
View Details
Fgf1 (NM_010197) Mouse Tagged ORF Clone
MG201152 10 µg

Fgf1 (NM_010197) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Human IgE
FA-2104-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human IgE

Sign In for Pricing
View Details
PTK7 Antibody
KC-7425-01 50 μL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-7425-02 100 µL

PTK7 Antibody

Sign In for Pricing
View Details
PTK7 Antibody
KC-7425-03 1 mL

PTK7 Antibody

Sign In for Pricing
View Details