Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAQ Peptide - middle region

YWHAQ Peptide - middle region

Product Specifications

Product Name Alternative

1C5, HS1, 14-3-3

UniProt

P27348

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006817.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromo-4-aminobenzoic Acid
TRC-B679450-250MG 250 mg

2-Bromo-4-aminobenzoic Acid

Sign In for Pricing
View Details
GUCY1A1 (NM_000856) Human Recombinant Protein
TP306063L 1 mg

GUCY1A1 (NM_000856) Human Recombinant Protein

Sign In for Pricing
View Details
Hospital bed stainless steel BHBD-709
BHBD-709 1 Unit

Hospital bed stainless steel BHBD-709

Sign In for Pricing
View Details
SLC40A1 Polyclonal Antibody
E-AB-19866-01 20 µL

SLC40A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC40A1 Polyclonal Antibody
E-AB-19866-02 60 µL

SLC40A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC40A1 Polyclonal Antibody
E-AB-19866-03 120 µL

SLC40A1 Polyclonal Antibody

Sign In for Pricing
View Details