Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAQ Peptide - middle region

YWHAQ Peptide - middle region

Product Specifications

Product Name Alternative

1C5, HS1, 14-3-3

UniProt

P27348

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006817.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant p73 Antibody
RC-4629-01 50 μL

Recombinant p73 Antibody

Sign In for Pricing
View Details
Recombinant p73 Antibody
RC-4629-02 100 µL

Recombinant p73 Antibody

Sign In for Pricing
View Details
Recombinant p73 Antibody
RC-4629-03 1 mL

Recombinant p73 Antibody

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL
BNC881798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FES Antibody
KC-993-01 50 μL

FES Antibody

Sign In for Pricing
View Details
FES Antibody
KC-993-02 100 µL

FES Antibody

Sign In for Pricing
View Details