HLA-B Peptide - middle region
HLA-B Peptide - middle region
Product Specifications
Product Name Alternative
AS, HLAB, B-4901
UniProt
P30461
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TL300852 1 Kit
RNF86 (TRIM2) Human shRNA Plasmid Kit (Locus ID 23321)
Sign In for Pricing
View Details 
MBS2054821-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Complement Component 1, Q Receptor (C1qR1)
Sign In for Pricing
View Details MBS2054821-02 0.2 mL
Cy3-Linked Polyclonal Antibody to Complement Component 1, Q Receptor (C1qR1)
Sign In for Pricing
View Details MBS2054821-03 0.5 mL
Cy3-Linked Polyclonal Antibody to Complement Component 1, Q Receptor (C1qR1)
Sign In for Pricing
View Details MBS2054821-04 1 mL
Cy3-Linked Polyclonal Antibody to Complement Component 1, Q Receptor (C1qR1)
Sign In for Pricing
View Details