What is the catalog number for HLA-B Peptide - middle region?

The catalog number for HLA-B Peptide - middle region is orb1998419.

What sizes are available for HLA-B Peptide - middle region?

HLA-B Peptide - middle region is available in the following size(s): 100 µg.

Is HLA-B Peptide - middle region in stock?

HLA-B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HLA-B Peptide - middle region

Product Specifications

Product Name Alternative

AS, HLAB, B-4901

UniProt

P30461

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRFDSDATSPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORF052956 1.0 µg DNA

Olfr828 ORF Vector (Mouse) (pORF)

Sign In for Pricing

View Details

NBP2-73542JF646 0.1 mL

Mouse Monoclonal PP1 alpha/PPP1A Antibody (OTI6E5) [Janelia Fluor 646]

Sign In for Pricing

View Details

AMM15201VCF 100 µg

WNT3 Mouse Monoclonal Antibody [Clone ID: LBI3F5]

Sign In for Pricing

View Details

PV169530 500 ng

Cyp2c40 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing

View Details

orb2931789-01 20 µg

Recombinant Mouse Amphiregulin (Areg)

Sign In for Pricing

View Details

orb2931789-02 100 µg

Recombinant Mouse Amphiregulin (Areg)

Sign In for Pricing

View Details