Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP12 Peptide - middle region

CASP12 Peptide - middle region

Product Specifications

Product Name Alternative

CASP-12, CASP12P1

UniProt

Q6UXS9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177945.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Breast
CB521678 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
CORO1C Antibody
KC-31128-01 50 μL

CORO1C Antibody

Sign In for Pricing
View Details
CORO1C Antibody
KC-31128-02 100 µL

CORO1C Antibody

Sign In for Pricing
View Details
CORO1C Antibody
KC-31128-03 1 mL

CORO1C Antibody

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FMOC-Lys (TQ3) -OH
5258-AAT 100 mg

FMOC-Lys (TQ3) -OH

Sign In for Pricing
View Details