Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP12 Peptide - middle region

CASP12 Peptide - middle region

Product Specifications

Product Name Alternative

CASP-12, CASP12P1

UniProt

Q6UXS9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177945.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELDLLGMRDLLENLGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase IX (CA9) Human Gene Knockout Kit (CRISPR)
KN204839LP 1 Kit

Carbonic Anhydrase IX (CA9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF647 conjugate, 0.1mg/mL
BNC473594-500 1x 500 µL

Cytokeratin 5 (KRT5) (Basal, Myoepithelial & Mesothelial Cell Marker) (KRT5/3594), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-01 20 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-02 60 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-03 120 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details
PSPC1 Polyclonal Antibody
E-AB-18827-04 200 µL

PSPC1 Polyclonal Antibody

Sign In for Pricing
View Details