CASP12 Peptide - middle region
CASP12 Peptide - middle region
Product Specifications
Product Name Alternative
CASP-12, CASP12P1
UniProt
Q6UXS9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001177945.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV667759 1.0 µg DNA
Olr1073 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
126019-FITC 100 µL
DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) (FITC)
Sign In for Pricing
View Details 
bsm-62563R-Biotin 100 µL
COPS4 Recombinant Antibody, Biotin Conjugated
Sign In for Pricing
View Details 124004-ML550 100 µL
BRIX1 (BXDC2, Ribosome Biogenesis Protein BRX1 Homolog, Brix Domain-containing Protein 2, BRIX, BXDC2, FLJ11100) (MaxLight 550)
Sign In for Pricing
View Details