Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP12 Peptide - middle region

CASP12 Peptide - middle region

Product Specifications

Product Name Alternative

CASP-12, CASP12P1

UniProt

Q6UXS9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001177945.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (15I3) Rabbit Monoclonal Antibody
E28M2466 100 µL

Chromogranin A (15I3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Escherichia coli (E. coli) (MaxLight 405)
MBS6188141-01 0.1 mL

Escherichia coli (E. coli) (MaxLight 405)

Sign In for Pricing
View Details
Escherichia coli (E. coli) (MaxLight 405)
MBS6188141-02 5x 0.1 mL

Escherichia coli (E. coli) (MaxLight 405)

Sign In for Pricing
View Details
DLG5 Recombinant Protein
OPCD00367-50UG 50 µg

DLG5 Recombinant Protein

Sign In for Pricing
View Details
Ttll9 (NM_001083618) Mouse Tagged ORF Clone Lentiviral Particle
MR217904L3V 200 µL

Ttll9 (NM_001083618) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant human POR protein
ATGP4107-020 20 µg

Recombinant human POR protein

Sign In for Pricing
View Details