Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHDRBS1 Peptide - C-terminal region

KHDRBS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P62, p68, Sam68

UniProt

Q07666

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREH

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHODH Human Gene Knockout Kit (CRISPR)
KN409034 1 Kit

DHODH Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD121a/IL1R1 Protein, N-GST
E55P1133 50 µg

Recombinant Human CD121a/IL1R1 Protein, N-GST

Sign In for Pricing
View Details
Ampicillin (AP) ELISA Kit
EKF1037 96 Tests

Ampicillin (AP) ELISA Kit

Sign In for Pricing
View Details
hsa-miR-4795-5p miRNA Antagomir
MNH02719 2x 5.0 nmol

hsa-miR-4795-5p miRNA Antagomir

Sign In for Pricing
View Details
CD304/Neuropilin-1 Rabbit PolymAb
MBS9148126-01 0.02 mL

CD304/Neuropilin-1 Rabbit PolymAb

Sign In for Pricing
View Details
CD304/Neuropilin-1 Rabbit PolymAb
MBS9148126-02 0.1 mL

CD304/Neuropilin-1 Rabbit PolymAb

Sign In for Pricing
View Details