Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLII Peptide - C-terminal region

FLII Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLI, FLIL, Fli1

UniProt

Q13045

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243193.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VINEGEEPENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CytoLinerTM 410/450 Fixed Cell Membrane Stain, 250 labelings
#30131-T 1 Kit

CytoLinerTM 410/450 Fixed Cell Membrane Stain, 250 labelings

Sign In for Pricing
View Details
Human Sphingosine 1 phosphate phosphatase 2 (SGPP2) activation kit by CRISPRa
GA115110 1 Kit

Human Sphingosine 1 phosphate phosphatase 2 (SGPP2) activation kit by CRISPRa

Sign In for Pricing
View Details
CLIC1 Rabbit Polyclonal Antibody
ER2001-32 100 µL

CLIC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
INSL3 (NM_005543) Human Recombinant Protein
TP309944L 1 mg

INSL3 (NM_005543) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565602 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI6E4]
CF808751 100 µg

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody [Clone ID: OTI6E4]

Sign In for Pricing
View Details