SMC6 Peptide - N-terminal region
SMC6 Peptide - N-terminal region
Product Specifications
Product Name Alternative
SMC-6, hSMC6, SMC6L1
UniProt
Q96SB8
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001135758.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM3076-50 1x 50 µL
APC / Adenomatous Polyposis Coli / FAP (Tumor Suppressor) (ALi 12-28), 1mg/mL
Sign In for Pricing
View Details 
BNC043647-500 1x 500 µL
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
H-1901-1 1 mg
HRP Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-
Sign In for Pricing
View Details 
