Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC6 Peptide - N-terminal region

SMC6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SMC-6, hSMC6, SMC6L1

UniProt

Q96SB8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135758.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW7 Human Gene Knockout Kit (CRISPR)
KN417398 1 Kit

FBXW7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hexafluoroacetone Trihydrate
TRC-H294913-500MG 500 mg

Hexafluoroacetone Trihydrate

Sign In for Pricing
View Details
Valeric Acid Sodium Salt
TRC-V091420-500MG 500 mg

Valeric Acid Sodium Salt

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-01 50 μL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-02 100 µL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details
Recombinant OGG1 Antibody
RC-15620-03 1 mL

Recombinant OGG1 Antibody

Sign In for Pricing
View Details