NUP88 Peptide - middle region
NUP88 Peptide - middle region
Product Specifications
UniProt
Q99567
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001307582.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CPSRYHCTHEAGVHSVGLTWIHKLHKFLGSDEEDKDSLQELSTEQKCFVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS096089-01 48 Well
Rat Nitric Oxide Synthase Trafficker ELISA Kit
Sign In for Pricing
View Details MBS096089-02 96 Well
Rat Nitric Oxide Synthase Trafficker ELISA Kit
Sign In for Pricing
View Details MBS096089-03 5x 96 Well
Rat Nitric Oxide Synthase Trafficker ELISA Kit
Sign In for Pricing
View Details MBS096089-04 10x 96 Well
Rat Nitric Oxide Synthase Trafficker ELISA Kit
Sign In for Pricing
View Details 