Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC13 Peptide - middle region

HOXC13 Peptide - middle region

Product Specifications

Product Name Alternative

HOX3, ECTD9, HOX3G

UniProt

P31276

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_059106.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC30A3 Polyclonal Antibody
ANT-14432-50ug 50 µg

SLC30A3 Polyclonal Antibody

Sign In for Pricing
View Details
CD69 antibody (PE)
61R-CD69aMSPE 200 ug

CD69 antibody (PE)

Sign In for Pricing
View Details
Anti-Human IL27 Antibody (SAA0393), FITC
MBS1585280-01 50 Tests

Anti-Human IL27 Antibody (SAA0393), FITC

Sign In for Pricing
View Details
Anti-Human IL27 Antibody (SAA0393), FITC
MBS1585280-02 100 Tests

Anti-Human IL27 Antibody (SAA0393), FITC

Sign In for Pricing
View Details
Anti-Human IL27 Antibody (SAA0393), FITC
MBS1585280-03 5x 100 Tests

Anti-Human IL27 Antibody (SAA0393), FITC

Sign In for Pricing
View Details
GLUT-1, Antibody
GWB-7AE487 1 mL

GLUT-1, Antibody

Sign In for Pricing
View Details