Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC13 Peptide - middle region

HOXC13 Peptide - middle region

Product Specifications

Product Name Alternative

HOX3, ECTD9, HOX3G

UniProt

P31276

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_059106.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFASSYQAMPGYLDVSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBS 1X with NP-40
40120357-1 250 mL

PBS 1X with NP-40

Sign In for Pricing
View Details
Rat Spint3 Pre-designed siRNA Set A
SI213660A 1 Each

Rat Spint3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
9930012K11Rik Double Nickase Plasmid (m)
sc-435277-NIC 20 µg

9930012K11Rik Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Human Colon Epithelial Cell Culture Medium
ARM1034 500 mL

Human Colon Epithelial Cell Culture Medium

Sign In for Pricing
View Details
REXO4 (NM_020385) Human Tagged ORF Clone
RC202528 10 µg

REXO4 (NM_020385) Human Tagged ORF Clone

Sign In for Pricing
View Details
LHX8 Rabbit Polyclonal Antibody
E28PN0820 100 µL

LHX8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details