Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORT1 Peptide - middle region

SORT1 Peptide - middle region

Product Specifications

Product Name Alternative

NT3, Gp95, NTR3, LDLCQ6

UniProt

Q99523

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001192157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDC2/PHC2 Antibody Blocking Peptide
orb1515188 500 µg

HDC2/PHC2 Antibody Blocking Peptide

Sign In for Pricing
View Details
NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (PE)
MBS6370220-01 0.1 mL

NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (PE)

Sign In for Pricing
View Details
NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (PE)
MBS6370220-02 5x 0.1 mL

NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (PE)

Sign In for Pricing
View Details
RGS17 Protein, Human, Recombinant (GST)
TMPH-02020-01 5 µg

RGS17 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
RGS17 Protein, Human, Recombinant (GST)
TMPH-02020-02 10 µg

RGS17 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details
RGS17 Protein, Human, Recombinant (GST)
TMPH-02020-03 20 µg

RGS17 Protein, Human, Recombinant (GST)

Sign In for Pricing
View Details