What is the catalog number for CSRP2 Peptide - middle region?

The catalog number for CSRP2 Peptide - middle region is orb1998403.

What sizes are available for CSRP2 Peptide - middle region?

CSRP2 Peptide - middle region is available in the following size(s): 100 µg.

Is CSRP2 Peptide - middle region in stock?

CSRP2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CSRP2 Peptide - middle region

Product Specifications

Product Name Alternative

CRP2, LMO5, SmLIM

UniProt

P21291

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287894.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

467579-01 500 µg

Threo-1-C-Syringylglycerol

Sign In for Pricing

View Details

467579-02 1 mg

Threo-1-C-Syringylglycerol

Sign In for Pricing

View Details

K0004-ML650 100 µL

Kaiso (Zinc Finger and BTB Domain Containing 33, ZBTB33) (MaxLight 650) discontinued

Sign In for Pricing

View Details

NB110-79874IR 0.1 mL

Rabbit Polyclonal CNPase Antibody [DyLight 755]

Sign In for Pricing

View Details

37945124 3x 1.0µg DNA

PSMA6 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing

View Details

SL5524R-01 50 µL

Rabbit Anti-phospho-NDEL1 (Thr219) antibody

Sign In for Pricing

View Details