Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP30 Peptide - middle region

RPP30 Peptide - middle region

Product Specifications

Product Name Alternative

TSG15

UniProt

P78346

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001098016.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLFGLSESD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ki67/MKI67 Antibody Picoband® Fluoro488 Conjugated
PB9026-Fluoro488 100 µg/Vial

Anti-Ki67/MKI67 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Ramosetron-d3 hydrochloride
FDC26604-01 5 mg

Ramosetron-d3 hydrochloride

Sign In for Pricing
View Details
Ramosetron-d3 hydrochloride
FDC26604-02 10 mg

Ramosetron-d3 hydrochloride

Sign In for Pricing
View Details
Ramosetron-d3 hydrochloride
FDC26604-03 25 mg

Ramosetron-d3 hydrochloride

Sign In for Pricing
View Details
Ramosetron-d3 hydrochloride
FDC26604-04 50 mg

Ramosetron-d3 hydrochloride

Sign In for Pricing
View Details
Recombinant Human STAT5B protein
MBS1562506-01 0.05 mg

Recombinant Human STAT5B protein

Sign In for Pricing
View Details