Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R10 Peptide - middle region

PPP1R10 Peptide - middle region

Product Specifications

Product Name Alternative

P99, FB19, R111, CAT53, PNUTS, PP1R10

UniProt

Q96QC0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002705.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADRB2 Protein Vector (Human) (pPM-N-D-C-HA)
PV320228 500 ng

ADRB2 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
anti-ALDH3B1
YF-PA10150 50 ul

anti-ALDH3B1

Sign In for Pricing
View Details
Recombinant Human FN3K, GST-tagged
FN3K-12951H 25 µg

Recombinant Human FN3K, GST-tagged

Sign In for Pricing
View Details
Goat Myozenin 1 (MYOZ1) ELISA Kit
MBS7259070-01 48 Well

Goat Myozenin 1 (MYOZ1) ELISA Kit

Sign In for Pricing
View Details
Goat Myozenin 1 (MYOZ1) ELISA Kit
MBS7259070-02 96 Well

Goat Myozenin 1 (MYOZ1) ELISA Kit

Sign In for Pricing
View Details
Goat Myozenin 1 (MYOZ1) ELISA Kit
MBS7259070-03 5x 96 Well

Goat Myozenin 1 (MYOZ1) ELISA Kit

Sign In for Pricing
View Details