Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R10 Peptide - middle region

PPP1R10 Peptide - middle region

Product Specifications

Product Name Alternative

P99, FB19, R111, CAT53, PNUTS, PP1R10

UniProt

Q96QC0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002705.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNEPPPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CCR2 Rabbit Monoclonal Antibody
MA1674-.1 100 µL

Anti-CCR2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human HEAT repeat-containing protein 5A (HEATR5A) ELISA Kit
abx527565 96 Tests

Human HEAT repeat-containing protein 5A (HEATR5A) ELISA Kit

Sign In for Pricing
View Details
CDKN2AIP Knockout 786-O Polyclonal Cells
ARG4890 1 Million

CDKN2AIP Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
TREM1 Polyclonal Antibody Cy3 Conjugated
C00689Cy3 100 µL

TREM1 Polyclonal Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Human FKRP (NM_024301) AAV Particle
RC200941A1V 250 µL

Human FKRP (NM_024301) AAV Particle

Sign In for Pricing
View Details
BglB Antibody
orb810783 2 mg

BglB Antibody

Sign In for Pricing
View Details