SETMAR Peptide - middle region
SETMAR Peptide - middle region
Product Specifications
Product Name Alternative
Mar1, HsMar1, METNASE
UniProt
Q53H47
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001230652.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4297407 1.0 µg DNA
Zscan20 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details NBP2-73185CL1 0.1 mL
Mouse Monoclonal p18INK4c/CDKN2C Antibody (OTI2E1) [CoraFluor 1]
Sign In for Pricing
View Details 
orb887330 100 µL
Transglutaminase-1 Rabbit Polyclonal Antibody (AP)
Sign In for Pricing
View Details 