SETMAR Peptide - middle region
SETMAR Peptide - middle region
Product Specifications
Product Name Alternative
Mar1, HsMar1, METNASE
UniProt
Q53H47
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001230652.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
246583 100 µg
GHRL (Ghrelin/obestatin Prepropeptide, MTLRP, obestatin)
Sign In for Pricing
View Details 
MBS2600686-01 48 Well
Rabbit Anti-lymphocyte Immunoglobulin (ALG) ELISA Kit
Sign In for Pricing
View Details MBS2600686-02 96 Well
Rabbit Anti-lymphocyte Immunoglobulin (ALG) ELISA Kit
Sign In for Pricing
View Details MBS2600686-03 5x 96 Well
Rabbit Anti-lymphocyte Immunoglobulin (ALG) ELISA Kit
Sign In for Pricing
View Details MBS2600686-04 10x 96 Well
Rabbit Anti-lymphocyte Immunoglobulin (ALG) ELISA Kit
Sign In for Pricing
View Details