Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN1 Peptide - C-terminal region

CLSTN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CST-1, CSTN1, CDHR12, PIK3CD, ALC-ALPHA, XB31alpha, alcalpha1, alcalpha2

UniProt

O94985

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENEMDWDDSALTITVNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Erythronolactone
TRC-E658500-5G 5 g

D-Erythronolactone

Sign In for Pricing
View Details
Live-or-Dye NucFixTM Red Staining Kit, Trial Size (50 assays)
#32010-T 1 Kit

Live-or-Dye NucFixTM Red Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details
PPHLN Antibody
8C11370-AAT 50 µg

PPHLN Antibody

Sign In for Pricing
View Details
Human Mohawk homeobox (MKX) activation kit by CRISPRa
GA116978 1 Kit

Human Mohawk homeobox (MKX) activation kit by CRISPRa

Sign In for Pricing
View Details
EIF3S1 (EIF3J) Human Gene Knockout Kit (CRISPR)
KN401188 1 Kit

EIF3S1 (EIF3J) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TTC12 (NM_017868) Human Recombinant Protein
TP317476L 1 mg

TTC12 (NM_017868) Human Recombinant Protein

Sign In for Pricing
View Details