Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN1 Peptide - C-terminal region

CLSTN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CST-1, CSTN1, CDHR12, PIK3CD, ALC-ALPHA, XB31alpha, alcalpha1, alcalpha2

UniProt

O94985

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001009566.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVCVSFLVFMIILGVFRIRAAHRRTMRDQDTGKENEMDWDDSALTITVNP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube Furnace BFTU-1300-20-250
BFTU-1300-20-250 1 Unit

Tube Furnace BFTU-1300-20-250

Sign In for Pricing
View Details
TRITC Conjugated Goat Affinity Purified Antibody to Mouse IgM
RAF-445-1 1 mL

TRITC Conjugated Goat Affinity Purified Antibody to Mouse IgM

Sign In for Pricing
View Details
Capsazepine
TRC-C175710-50MG 50 mg

Capsazepine

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-01 50 μL

RING1 Antibody

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-02 100 µL

RING1 Antibody

Sign In for Pricing
View Details
RING1 Antibody
KC-46211-03 1 mL

RING1 Antibody

Sign In for Pricing
View Details