Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WAPL Peptide - middle region

WAPL Peptide - middle region

Product Specifications

Product Name Alternative

FOE, WAPAL, KIAA0261

UniProt

Q7Z5K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001305257.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRPSNTKSKKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Kidney
CD564340 5 µg

Tissue Genomic DNA, Kidney

Sign In for Pricing
View Details
Fenbuconazole-lactone A R-9129
TRC-T767725-1MG 1 mg

Fenbuconazole-lactone A R-9129

Sign In for Pricing
View Details
Aurothioglucose 80%
TRC-A794790-5MG 5 mg

Aurothioglucose 80%

Sign In for Pricing
View Details
(AlphaR,1R)-Alpha-Bisabolol
TRC-B399803-1MG 1 mg

(AlphaR,1R)-Alpha-Bisabolol

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL
BNC471870-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1870), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BC085271 Mouse Gene Knockout Kit (CRISPR)
KN502068 1 Kit

BC085271 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details