Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDC Peptide - middle region

PDC Peptide - middle region

Product Specifications

Product Name Alternative

PHD, MEKA, PhLP, PhLOP

UniProt

P20941

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002588.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEILRQMSSPQSRNGKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RX-3117
BA2925-10 10 mg

RX-3117

Sign In for Pricing
View Details
Procalcitonin (PCT) Mouse mAb, Cy3 conjugated
orb2821697 100 µL

Procalcitonin (PCT) Mouse mAb, Cy3 conjugated

Sign In for Pricing
View Details
MHC Class II, beta Chain (MHC Class II beta Chain, MHC Class II, MHC II) (FITC)
MBS6261909-01 0.1 mL

MHC Class II, beta Chain (MHC Class II beta Chain, MHC Class II, MHC II) (FITC)

Sign In for Pricing
View Details
MHC Class II, beta Chain (MHC Class II beta Chain, MHC Class II, MHC II) (FITC)
MBS6261909-02 5x 0.1 mL

MHC Class II, beta Chain (MHC Class II beta Chain, MHC Class II, MHC II) (FITC)

Sign In for Pricing
View Details
KRT31/33A/33B Antibody
DF2553-01 100 µL

KRT31/33A/33B Antibody

Sign In for Pricing
View Details
KRT31/33A/33B Antibody
DF2553-02 200 µL

KRT31/33A/33B Antibody

Sign In for Pricing
View Details