Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKI Peptide - middle region

SKI Peptide - middle region

Product Specifications

Product Name Alternative

SGS, SKV

UniProt

P12755

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003027.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Diisopropylurea
TRC-D459850-50MG 50 mg

1,3-Diisopropylurea

Sign In for Pricing
View Details
HRP Conjugated Solanum tuberosum (Potato) -STA-
H-4701-1 1 mg

HRP Conjugated Solanum tuberosum (Potato) -STA-

Sign In for Pricing
View Details
Adenosine 5'-Diphosphate Sodium Salt
TRC-A281708-25G 25 g

Adenosine 5'-Diphosphate Sodium Salt

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF594 conjugate, 0.1mg/mL
BNC941975-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SLC25A35 activation kit by CRISPRa
GA118242 1 Kit

Human SLC25A35 activation kit by CRISPRa

Sign In for Pricing
View Details
EFEMP2 Rabbit Polyclonal Antibody
AP01398PU-N 100 µg

EFEMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details