Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKI Peptide - middle region

SKI Peptide - middle region

Product Specifications

Product Name Alternative

SGS, SKV

UniProt

P12755

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003027.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDDTSSQSPAPSEKDKPSSWLRTLAGSSNKSLGCVHPRQRLSAFRPWSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ataxin 3 (ATXN3) (NM_001127697) Human Over-expression Lysate
LY432176 100 µg

Ataxin 3 (ATXN3) (NM_001127697) Human Over-expression Lysate

Sign In for Pricing
View Details
Vgll2 Mouse Gene Knockout Kit (CRISPR)
KN518885 1 Kit

Vgll2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DLX4 Mouse Monoclonal Antibody [Clone ID: OTI7H10]
CF808582 100 µg

DLX4 Mouse Monoclonal Antibody [Clone ID: OTI7H10]

Sign In for Pricing
View Details
Sodium Fruquintinib O-Desquinazolyl,-O-sulfate
TRC-S965620-25MG 25 mg

Sodium Fruquintinib O-Desquinazolyl,-O-sulfate

Sign In for Pricing
View Details
NBR1 Mouse Monoclonal Antibody [Clone ID: 7H2-4B2-6D6]
TA384838 100 µL

NBR1 Mouse Monoclonal Antibody [Clone ID: 7H2-4B2-6D6]

Sign In for Pricing
View Details
WIPI2 (2A2), CF647 conjugate, 0.1mg/mL
BNC472904-500 1x 500 µL

WIPI2 (2A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details