NBN Peptide - C-terminal region
NBN Peptide - C-terminal region
Product Specifications
Product Name Alternative
ATV, NBS, P95, NBS1, AT-V1, AT-V2
UniProt
O60934
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001019859.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
49019064 1.0 µg DNA
UBE3C Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MBS6212923-01 0.1 mL
Oncofetal Antigen 5T4 (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (MaxLight 550)
Sign In for Pricing
View Details MBS6212923-02 5x 0.1 mL
Oncofetal Antigen 5T4 (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (MaxLight 550)
Sign In for Pricing
View Details