Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBN Peptide - C-terminal region

NBN Peptide - C-terminal region

Product Specifications

Product Name Alternative

ATV, NBS, P95, NBS1, AT-V1, AT-V2

UniProt

O60934

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001019859.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADGRG2/GPR64 Mouse Monoclonal Antibody
orb2958741-01 50 µg

ADGRG2/GPR64 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ADGRG2/GPR64 Mouse Monoclonal Antibody
orb2958741-02 100 µg

ADGRG2/GPR64 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ADGRG2/GPR64 Mouse Monoclonal Antibody
orb2958741-03 1 mg

ADGRG2/GPR64 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
RAB31 Rabbit pAb, PE-Cy5 conjugated
orb2883875 100 µL

RAB31 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal USP13 Antibody [HRP]
NBP1-46203H 0.1 mL

Rabbit Polyclonal USP13 Antibody [HRP]

Sign In for Pricing
View Details
LRRC48 Protein Vector (Human) (pPB-N-His)
PV024350 500 ng

LRRC48 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details