Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRM Peptide - C-terminal region

NRM Peptide - C-terminal region

Product Specifications

Product Name Alternative

NRM29

UniProt

Q8IXM6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNRG (C-term) Rabbit Polyclonal Antibody
AP52319PU-N 400 µL

KCNRG (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL
BNC682540-500 1x 500 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD115/CSF-1R Antibody[AFS98]
E-AB-F1107UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD115/CSF-1R Antibody[AFS98]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD115/CSF-1R Antibody[AFS98]
E-AB-F1107UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD115/CSF-1R Antibody[AFS98]

Sign In for Pricing
View Details
TAF7L (NM_001168474) Human Over-expression Lysate
LC432964 20 µg

TAF7L (NM_001168474) Human Over-expression Lysate

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL
BNC741828-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details