Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRM Peptide - C-terminal region

NRM Peptide - C-terminal region

Product Specifications

Product Name Alternative

NRM29

UniProt

Q8IXM6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD2 (NM_001003652) Human Over-expression Lysate
LC400372 20 µg

SMAD2 (NM_001003652) Human Over-expression Lysate

Sign In for Pricing
View Details
Ibuprofen 2-Monoglyceride
TRC-I400140-250MG 250 mg

Ibuprofen 2-Monoglyceride

Sign In for Pricing
View Details
Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 58XB4]
AM33010PU-N 100 µg

Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 58XB4]

Sign In for Pricing
View Details
Uncoated Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit
E-UNEL-M0184-01 5x 96 Tests

Uncoated Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit
E-UNEL-M0184-02 15x 96 Tests

Uncoated Mouse IFABP/FABP2 (Intestinal Fatty Acid Binding Protein) ELISA Kit

Sign In for Pricing
View Details
HSZFP36 (ZNF823) (NM_001080493) Human Over-expression Lysate
LY421048 100 µg

HSZFP36 (ZNF823) (NM_001080493) Human Over-expression Lysate

Sign In for Pricing
View Details