Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP100 Peptide - middle region

SP100 Peptide - middle region

Product Specifications

Product Name Alternative

Lysp100b

UniProt

P23497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001073860.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVFISAPRSEPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPS6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]
TA505755BM 100 µL

COPS6 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H4]

Sign In for Pricing
View Details
CGB2 Human Gene Knockout Kit (CRISPR)
KN421679 1 Kit

CGB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Skin
CP528578 150 µg

Tissue Protein Lysate, Skin

Sign In for Pricing
View Details
Recombinant Fibronectin Antibody
RC-15286-01 50 μL

Recombinant Fibronectin Antibody

Sign In for Pricing
View Details
Recombinant Fibronectin Antibody
RC-15286-02 100 µL

Recombinant Fibronectin Antibody

Sign In for Pricing
View Details
Recombinant Fibronectin Antibody
RC-15286-03 1 mL

Recombinant Fibronectin Antibody

Sign In for Pricing
View Details