Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP100 Peptide - middle region

SP100 Peptide - middle region

Product Specifications

Product Name Alternative

Lysp100b

UniProt

P23497

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001073860.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVFISAPRSEPVINNDNPLESNDEKEGQEATCSRPQIVPEPMDFRKLSTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS700870 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Stx2 Mouse Gene Knockout Kit (CRISPR)
KN516929 1 Kit

Stx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SUZ12 Rabbit Monoclonal Antibody
TA422854 100 µL

SUZ12 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
BID pSer65 Rabbit Polyclonal Antibody
AP12572PU-N 400 µL

BID pSer65 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QuantiChrom™ Iron Assay Kit
DIFE-250 250 Tests

QuantiChrom™ Iron Assay Kit

Sign In for Pricing
View Details
RAC1 Recombinant Rabbit Monoclonal Antibody [PSH05-09]
HA722225 100 µL

RAC1 Recombinant Rabbit Monoclonal Antibody [PSH05-09]

Sign In for Pricing
View Details