Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYCP3 Peptide - middle region

SYCP3 Peptide - middle region

Product Specifications

Product Name Alternative

COR1, SCP3, SPGF4, RPRGL4

UniProt

Q8IZU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171419.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody
CAU28869-01 100 µL

Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody

Sign In for Pricing
View Details
Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody
CAU28869-02 200 µL

Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody

Sign In for Pricing
View Details
Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody
CAU28869-03 1 mL

Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF) Polyclonal Antibody

Sign In for Pricing
View Details
Polr3f sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4059304 1.0 µg DNA

Polr3f sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human DPPA5 Pre-designed siRNA Set A
SI004535A 1 Each

Human DPPA5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Eotaxin/CCL11, Human (His)
HY-P700963 1 Each

Eotaxin/CCL11, Human (His)

Sign In for Pricing
View Details